.
The Open Protein Structure Annotation Network
PDB Keyword
.

3egl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of DegV Family Protein Cg2579 from Corynebacterium glutamicum. To be Published
    Site MCSG
    PDB Id 3egl Target Id APC20544
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS5205,CAF21014.1, 196627 Molecular Weight 28972.14 Da.
    Residues 274 Isoelectric Point 5.21
    Sequence mpvrvivdssaclpthvaedlditvinlhvmnngeerstsglsslelaasyarqlerggddgvlalhis kelsstwsaavtaaavfdddsvrvvdtsslgmavgaaamaaarmakdgaslqecydiavdtlkrsetwi ylhrideiwksgristatamvstalatrpimrfnggrmeiaaktrtqskafaklvelaqiradgepvfi aigqneareaakqleellrnalpegssfmsvdidptlavhsgpgavsvsavfanqapelstgkagak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.41 Rfree 0.218
    Matthews' coefficent 3.38 Rfactor 0.179
    Waters 458 Solvent Content 63.61

    Ligand Information
    Ligands PLM (PALMITIC) x 3;FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3egl
    1. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch