.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ehd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved protein (PF05014) Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3ehd Target Id APC29391
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS20347,AAO82079, 226185 Molecular Weight 17548.84 Da.
    Residues 159 Isoelectric Point 4.51
    Sequence mtkiyfagplfsqadlrynaylveqirqldktidlylpqenaaindksayadskmialadtenvlasdl lvalldgptidagvaseigvayakgipvvalytdsrqqgadnhqkldalneiaenqfhylnlytvglik lngrvvsseedlleeikqrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.20834
    Matthews' coefficent 3.09 Rfactor 0.16498
    Waters 244 Solvent Content 60.18

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ehd
    1. Structural Characterization of the Mammalian Deoxynucleotide N-Hydrolase Rcl and Its Stabilizing Interactions with Two Inhibitors
    Y Yang, A Padilla, C Zhang, G Labesse - Journal of molecular , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch