.
The Open Protein Structure Annotation Network
PDB Keyword
.

3elk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 3elk Target Id APC7587
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5161,CAC11490.1, 2303 Molecular Weight 13373.81 Da.
    Residues 117 Isoelectric Point 7.88
    Sequence mnsdptrerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvisessv nekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvdiienrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.241
    Matthews' coefficent 1.85 Rfactor 0.202
    Waters 129 Solvent Content 33.54

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch