.
The Open Protein Structure Annotation Network
PDB Keyword
.

3epq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fructokinase from Bacillus subtiliscomplexed with ADP. To be Published
    Site MCSG
    PDB Id 3epq Target Id APC1098
    Related PDB Ids 1xc3 3lm9 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4496,O05510, 1423 Molecular Weight 32438.29 Da.
    Residues 299 Isoelectric Point 5.18
    Sequence mlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfgpvdndktsqt ygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeakgldsclyitigtgigagaiv egrllqglshpemghiyirrhpddvyqgkcpyhgdcfeglasgpaiearwgkkaadlsdiaqvwelegy yiaqalaqyililapkkiilgggvmqqkqvfsyiyqyvpkimnsyldfselsddisdyivpprlgsnag iigtlvlahqalqaeaasgevrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.18165
    Matthews' coefficent 4.01 Rfactor 0.16004
    Waters 440 Solvent Content 69.34

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1;SO4 (SULFATE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch