.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the transcriptional regulator, TetR family from Cytophaga hutchinsonii. To be Published
    Site MCSG
    PDB Id 3eup Target Id APC88687
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS24488,YP_679452.1, PF00440.13, 269798 Molecular Weight 22275.35 Da.
    Residues 202 Isoelectric Point 7.70
    Sequence mkelsksdrtrqfiiestapvfnvkglagtsltdlteatnltkgsiygnfenkeavaiaafdynwghvk svltakvqacntykemllvyssmyndadgslfpvggcpllnttieaddthdalrkkageailswkknlv tiikkgiqakefrpdtdvtkiafsmialvegailihratknraysdyvfesledliagievkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.99 Rfree 0.22937
    Matthews' coefficent 2.41 Rfactor 0.18227
    Waters 261 Solvent Content 48.90

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch