.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eur

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain of uncharacterized protein from Bacteroides fragilis NCTC 9343. To be Published
    Site MCSG
    PDB Id 3eur Target Id APC61442.2
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS24481,CAH07289.1, 3.40.30.10, 272559 Molecular Weight 15903.50 Da.
    Residues 139 Isoelectric Point 8.44
    Sequence knrlgtkalnftytldsgvkgtlyqfpaeytllfinnpgchacaemieglkaspvingftaakklkvls iypdeeldewkkhrndfakewtngydkelviknknlydlraiptlylldknktvllkdatlqkveqylae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.17009
    Matthews' coefficent 2.19 Rfactor 0.13872
    Waters 235 Solvent Content 43.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eur
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch