.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eus

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the DNA binding protein from Silicibacter pomeroyi. To be Published
    Site MCSG
    PDB Id 3eus Target Id APC88631
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5918,YP_166464.1, PF01381.12, 246200 Molecular Weight 9485.41 Da.
    Residues 84 Isoelectric Point 6.57
    Sequence mtktlrtpehvylcqrlrqarldagltqadlaerldkpqsfvakvetrerrldviefakwmaacegldv vseivatiaegraqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.25375
    Matthews' coefficent 2.15 Rfactor 0.20099
    Waters 88 Solvent Content 42.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eus
    1. VITAL NMR: using chemical shift derived secondary structure information for a limited set of amino acids to assess homology model accuracy
    MC Brothers, AE Nesbitt, MJ Hallock - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch