.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ewl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved protein BF1870 of Unknown Function from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3ewl Target Id APC61443.2
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS24484,CAH07569.1, 3.40.30.10, 272559 Molecular Weight 16102.69 Da.
    Residues 139 Isoelectric Point 7.92
    Sequence gmkaadftyvtvhgdnsrmsrlkaqytmlffydpdcsncrkfeklfaeipafvemvengtlrvlaiypd enreewatkavympqgwivgwnkagdirtrqlydiratptiylldgrkrvilkdtsmeqlidylatqagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.241
    Matthews' coefficent Rfactor 0.184
    Waters 161 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch