.
The Open Protein Structure Annotation Network
PDB Keyword
.

3exc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the RNA'se SSO8090 from Sulfolobus solfataricus. To be Published
    Site MCSG
    PDB Id 3exc Target Id APC7957
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS25096,AAK54438.1, 273057 Molecular Weight 10223.37 Da.
    Residues 88 Isoelectric Point 8.06
    Sequence mkllvvydvsddskrnklannlkklgleriqrsafegdidsqrvkdlvrvvklivdtntdivhiiplgi rdwerrivigregleewlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.221
    Matthews' coefficent 2.85 Rfactor 0.191
    Waters 46 Solvent Content 56.80

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3exc
    1. Structure of a CRISPR-associated protein Cas2 from Desulfovibrio vulgaris
    P Samai, P Smith, S Shuman - Acta Crystallographica Section F: , 2010 - scripts.iucr.org
     
    2. Structural and biochemical characterization of HP0315 from Helicobacter pylori as a VapD protein with an endoribonuclease activity
    AR Kwon, JH Kim, SJ Park, KY Lee, YH Min - Nucleic Acids , 2012 - Oxford Univ Press
     
    3. Bacterial toxin-antitoxin systems
    J Guglielmini, L Van Melderen - 2012 - landes.bjmu.edu.cn
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch