.
The Open Protein Structure Annotation Network
PDB Keyword
.

3exn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acetyltransferase from Thermus thermophilus HB8. To be Published
    Site MCSG
    PDB Id 3exn Target Id APC61206
    Molecular Characteristics
    Source Thermus thermophilus hb8
    Alias Ids TPS5565,BAD69999.1, 3.40.630.30, 300852 Molecular Weight 17600.43 Da.
    Residues 157 Isoelectric Point 6.97
    Sequence mgamhvltldlapvtpkdapllhrvfhlspsyfaligmelptledvvrdlqtlevdprrrafllflgqe pvgyldaklgypeaedatlsllliredhqgrglgrqalerfaagldgvrrlyavvyghnpkakaffqaq gfryvkdggptltwyvrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21899
    Matthews' coefficent 2.22 Rfactor 0.17604
    Waters 108 Solvent Content 44.60

    Ligand Information
    Ligands ACO (ACETYL) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch