The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of V. Pseudocholerae. VPC_CASS1. To be Published
    Site MCSG
    PDB Id 3ey8 Target Id APC7783
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS28143,AUS0041_1_133, 491076 Molecular Weight 14630.95 Da.
    Residues 133 Isoelectric Point 5.07
    Sequence meflmkishldhlvltvadiptttkfyekvlgmkavsfgsgrialefglqkinlhqlghefepkaqnvr tgsadlcfitdidlsdameyvenqgvvimegpvkrtgaqgaitsfyfrdpdgnlievstysnt*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.1873
    Matthews' coefficent 1.98 Rfactor 0.1563
    Waters 320 Solvent Content 37.75

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch