.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f0c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator from Cytophaga hutchinsonii ATCC 33406. To be Published
    Site MCSG
    PDB Id 3f0c Target Id APC88832
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS5927,YP_677559.1, PF00440.13, 269798 Molecular Weight 24351.97 Da.
    Residues 210 Isoelectric Point 8.63
    Sequence mtdnkiknedgkleliinaaqkrfahyglckttmneiasdvgmgkaslyyyfpdketlfeavikkeqnv ffdemdkilnsgidatallkkyvklrslhfrhllnlsklrsdffhntkpvfakafesfkqkeveivagi iqygittkefkrgnkhenaeflvhlllgvrmvklkykeindfdesdyedldknmckvagmflkeiqtev asr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.96 Rfree 0.27083
    Matthews' coefficent 3.54 Rfactor 0.20883
    Waters Solvent Content 65.21

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3f0c
    1. Cleavable C-terminal His-tag vectors for structure determination
    WH Eschenfeldt, N Maltseva, L Stols - Journal of structural and , 2010 - Springer
     
    2. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch