.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f1b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR-like transcriptional regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 3f1b Target Id APC5888
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4902,RHA03765, 101510 Molecular Weight 21646.51 Da.
    Residues 199 Isoelectric Point 5.53
    Sequence maggtkrlpravreqqmldaavdvfsdrgfhetsmdaiaakaeiskpmlylyygskdelfaaciqregl rfvealapagdpglspreqlrralegflgfvgkhrkswmvlyrqamgqqafvgsvqssrdrlieltahl lesstkdpepgqdfeliaialvgageavadrvaggeievdaaadlleslawrglagkkkpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.27839
    Matthews' coefficent 2.12 Rfactor 0.22482
    Waters Solvent Content 41.92

    Ligand Information
    Ligands SO4 (SULFATE) x 3;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3f1b
    1. Structural plasticity and distinct drug-binding modes of LfrR, a mycobacterial efflux pump regulator
    M Bellinzoni, S Buroni, F Schaeffer - Journal of , 2009 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch