.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f3k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae. J.Biol.Chem. 285 21049-21059 2010
    Site MCSG
    PDB Id 3f3k Target Id APC7730
    Related PDB Ids 3ll4 3lg2 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS25090,NP_012969.1, 4932 Molecular Weight 31020.36 Da.
    Residues 271 Isoelectric Point 5.63
    Sequence mpsltprciivrhgqtewsksgqytgltdlpltpygegqmlrtgesvfrnnqflnpdnityiftsprlr arqtvdlvlkplsdeqrakirvvvdddlreweygdyegmltreiielrksrgldkerpwniwrdgceng ettqqiglrlsraiariqnlhrkhqsegrasdimvfahghalryfaaiwfglgvqkkcetieeiqnvks ydddtvpyvklesyrhlvdnpcflldaggigvlsyahhnidepalelagpfvsppeeesqhgdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.170
    Matthews' coefficent 2.98 Rfactor 0.141
    Waters 939 Solvent Content 58.66

    Ligand Information
    Ligands GOL (GLYCEROL) x 6
    Metals

    Jmol

     
    Google Scholar output for 3f3k
    1. Structure and Activity of the Metal-independent Fructose-1, 6-bisphosphatase YK23 from Saccharomyces cerevisiae
    E Kuznetsova, L Xu, A Singer, G Brown, A Dong - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch