.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f42

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 3f42 Target Id APC7762
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS24471,NP_206837.1, 85962 Molecular Weight 10723.62 Da.
    Residues 97 Isoelectric Point 4.62
    Sequence mdfsqlgglldgmkkefsqleeknkdtihtsksgggmvsvsfnglgelvdlqiddslledkeamqiylm salndgykaveenrknlafnmlgnfakl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.78 Rfree 0.21980
    Matthews' coefficent 2.19 Rfactor 0.17989
    Waters 142 Solvent Content 43.72

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3f42
    1. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch