The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Ygr203w, a yeast protein tyrosine phosphatase of the Rhodanese family. To be Published
    Site MCSG
    PDB Id 3f4a Target Id APC7727
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS25084,NP_011719.1, 4932 Molecular Weight 17247.68 Da.
    Residues 148 Isoelectric Point 7.01
    Sequence mdsysitnvkyldptelhrwmqeghtttlrepfqvvdvrgsdymgghikdgwhyaysrlkqdpeylrel khrllekqadgrgalnvifhcmlsqqrgpsaamlllrsldtaelsrcrlwvlrggfsrwqsvygddesv tagylpdlwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.21064
    Matthews' coefficent Rfactor 0.16575
    Waters 312 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 8;NH4 (AMMONIUM) x 1
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch