.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f5r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a subunit of the heterodimeric FACT complex (Spt16p-Pob3p). To be Published
    Site MCSG
    PDB Id 3f5r Target Id APC7736
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS24450,NP_013642.1, 4932 Molecular Weight 19244.39 Da.
    Residues 168 Isoelectric Point 6.75
    Sequence mstdfdriylnqskfsgrfriadsglgwkistsggsaanqarkpfllpatelstvqwsrgcrgydlkin tknqgviqldgfsqddynlikndfhrrfniqveqrehslrgwnwgktdlarnemvfalngkptfeipya rinntnltsknevgiefniqdeeyqpagde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.19211
    Matthews' coefficent 2.07 Rfactor 0.18079
    Waters 124 Solvent Content 40.68

    Ligand Information
    Ligands FMT (FORMIC) x 1;GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3f5r
    1. The histone chaperone FACT: structural insights and mechanisms for nucleosome reorganization
    DD Winkler, K Luger - Journal of Biological Chemistry, 2011 - ASBMB
     
    2. The role of FACT in making and breaking nucleosomes
    T Formosa - Biochimica et Biophysica Acta (BBA)-Gene Regulatory , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch