.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f67

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Dienelactone Hydrolase from Klebsiella pneumoniae subsp. pneumoniae MGH 78578. To be Published
    Site MCSG
    PDB Id 3f67 Target Id APC60631.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS24475,ABR79694.1, 3.40.50.1820, 272620 Molecular Weight 26387.41 Da.
    Residues 238 Isoelectric Point 5.73
    Sequence iiagetsipsqgenmpayharpknadgplpivivvqeifgvhehirdlcrrlaqegylaiapelyfrqg dpneyhdiptlfkelvskvpdaqvladldhvaswaarhggdahrllitgfcwggritwlyaahnpqlka avawygklvgekslnspkhpvdiavdlnapvlglygakdasipqdtvetmrqalraanataeivvypea dhafnadyrasyheesakdgwqrmlawfaqy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.198
    Matthews' coefficent 2.82 Rfactor 0.168
    Waters 295 Solvent Content 56.46

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;FMT (FORMIC) x 2;ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3f67
    1. Mapping the distribution of packing topologies within protein interiors shows predominant preference for specific packing motifs
    S Basu, D Bhattacharyya, R Banerjee - BMC bioinformatics, 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch