.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f6o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ArsR family transcriptional regulator, RHA00566. To be Published
    Site MCSG
    PDB Id 3f6o Target Id APC7226
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS25082,RHA00566, 101510 Molecular Weight 13456.61 Da.
    Residues 118 Isoelectric Point 6.51
    Sequence maqypeqlngifqaladptrravlgrlsrgpatvselakpfdmalpsfmkhihfledsgwirthkqgrv rtcaiekepftaveawlaeqqelwesrtdrleqfvtehtvtahakatpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24693
    Matthews' coefficent 2.14 Rfactor 0.21595
    Waters 159 Solvent Content 42.52

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 3

    Jmol

     
    Google Scholar output for 3f6o
    1. Purification, crystallization and preliminary X-ray diffraction studies of the arsenic repressor ArsR from Corynebacterium glutamicum
    S Santha, EPJ Pandaranayaka, BP Rosen - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch