.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f6w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title XRE-family like protein from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 3f6w Target Id APC88786
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5925,NP_790564.1, PF01381.12, 223283 Molecular Weight 8939.81 Da.
    Residues 80 Isoelectric Point 7.91
    Sequence mktihnaryqalldlllearsaagitqkelaarlgrpqsfvsktenaerrldviefmdfcrgigtdpya llskleamtps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.85 Rfree 0.2477
    Matthews' coefficent 2.59 Rfactor 0.1905
    Waters 587 Solvent Content 52.47

    Ligand Information
    Ligands BTB (2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch