.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C-terminal domain of putative exported cytochrome C biogenesis-related protein from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3f9u Target Id APC61444.1
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25136,CAH08728.1, 3.40.30.10, 272559 Molecular Weight 19455.10 Da.
    Residues 169 Isoelectric Point 5.73
    Sequence gaplkavsafappmktqdfnlytnevhakfddydlgmeyarqhnkpvmldftgygcvncrkmelavwtd pkvssiinndyvlitlyvdnktpltepvkimengtertlrtvgdkwsylqrvkfganaqpfyvlidneg nplnksyaydediskyinflqtglenyrkek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.23575
    Matthews' coefficent 2.34 Rfactor 0.18075
    Waters 189 Solvent Content 47.38

    Ligand Information
    Ligands NO3 (NITRATE) x 5;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3f9u
    1. Remote thioredoxin recognition using evolutionary conservation and structural dynamics
    GW Tang, RB Altman - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch