.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fbq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the conserved domain protein from Bacillus anthracis. To be Published
    Site MCSG
    PDB Id 3fbq Target Id APC89528
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS5956,AAT53944.1, 260799 Molecular Weight 40893.23 Da.
    Residues 366 Isoelectric Point 6.08
    Sequence mkdiyellndididekeleeieaseiekekvkrnvkqsirtkkkmkswkkgvaaasilvglsvttlgig fptyagglpivgdifrfldngrtglyenykefstelnmtresngvkvtindvisdgrtlsitysleseq dlgddpiilggldimdahgssgsgkmtkvtekkyvgmvttthhdsnkkdkvnfrwniegieipdrkksi qghwnfaltvksmdskertiggssekegikanmekvamspvsfilyynqevskgarkewdsvdveltvk ddlgndysgegnggsgndpynirwsatfqklnenatklivtprvhlrvhtpenhggveyvngkekkiev pnkeakkkdivlddividlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.71 Rfree 0.28285
    Matthews' coefficent 2.67 Rfactor 0.20584
    Waters 27 Solvent Content 53.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fbq
    1. The third pillar of bacterial signal transduction: classification of the extracytoplasmic function (ECF) _ factor protein family
    A Staro_, HJ Sofia, S Dietrich, LE Ulrich - Molecular , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch