The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acetyltransferase (GNAT family) from Bacillus anthracis. To be Published
    Site MCSG
    PDB Id 3fbu Target Id APC7650
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS5178,YP_028619.1, 260799 Molecular Weight 20063.95 Da.
    Residues 168 Isoelectric Point 5.91
    Sequence mfikaerllirkfefkdweavheytsdsdvmkyipegvfteedtrnfvnknmgenaknfpviligenil vghivfhkyfgehtyeigwvfnpkyfnkgyaseaaqatlkygfkemklhriiatcqpentpsyrvmeki gmrregyfkkciphgnewwdeyyyaileee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.22352
    Matthews' coefficent 2.12 Rfactor 0.19818
    Waters 181 Solvent Content 42.06

    Ligand Information
    Ligands COA (COENZYME) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch