.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fc7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of HTR-like protein from Haloarcula marismortui ATCC 43049. To be Published
    Site MCSG
    PDB Id 3fc7 Target Id APC87712.1
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS25165,AAV45512.1, 3.30.450.20, 272569 Molecular Weight 13203.84 Da.
    Residues 122 Isoelectric Point 5.76
    Sequence lanrienvvsqertrkkfeslvsdspdgivhlttngtilsvnpsmagrlgadpdtlvgqqlsavmdsea anqrleagksavengtatrsedavggrhyhnqyipvdshrksdtfqlvsrdit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.27396
    Matthews' coefficent 2.02 Rfactor 0.20230
    Waters 7 Solvent Content 39.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fc7
    1. Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
    RK Jaiswal, G Manjeera, B Gopal - Biochemical and biophysical research , 2010 - Elsevier
     
    2. The Zinc Regulated Antivirulence Pathway of Salmonella is a Multi-protein Immunoglobulin Adhesion System
    G Prehna, Y Li, N Stoynov, M Okon, M Vukovic - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch