.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fd3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal domains of a LysR family protein from Agrobacterium tumefaciens str. C58. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fd3 Target Id APC7761
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS25094,NP_531626.1, 176299 Molecular Weight 34241.60 Da.
    Residues 319 Isoelectric Point 6.24
    Sequence mvcsgapvaliptssgaimldypsmravalvartgsfekaaqvlcvtpsavsqrikqleerlgvvlivr gnpcvatekgewlcrhmdhvgmleselfrqlpalteagdaqervtlniatnadslgtwfldavskftgg sdylvniavddqdhtvewlrggrvlaavtahdkpvqgcrvtplgvlryhataspdfmarhfadgvtpaa larapgltfnqkdrlqaswirtalgedvsypthwlpstdgfvkaslagmgwglnpvqlvaehlaagrlv elmpgtpldiplywqvnrlaaerlagltanmvgtarvvlmpvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.200
    Matthews' coefficent 2.99 Rfactor 0.169
    Waters 236 Solvent Content 58.84

    Ligand Information
    Ligands P33 (3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL) x 1;PG4 (TETRAETHYLENE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3fd3
    1. Full-length structures of BenM and two variants reveal different oligomerization schemes for LysR-type transcriptional regulators
    A Ruangprasert, SH Craven, EL Neidle - Journal of molecular , 2010 - Elsevier
     
    2. Crystallization and preliminary crystal structure analysis of the ligand-binding domain of PqsR (MvfR), the Pseudomonas quinolone signal (PQS) responsive quorum-
    N Xu, S Yu, S Moniot, M Weyand - Section F: Structural , 2012 - scripts.iucr.org
     
    3. Structural characterization and biophysical studies of BenM, a LysR-type transcriptional regulator in Acinetobacter baylyi ADP1
    A Ruangprasert - 2010 - ugakr-maint.libs.uga.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch