.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fdg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the dipeptidase AC, Metallo peptidase. MEROPS family M19. To be Published
    Site MCSG
    PDB Id 3fdg Target Id APC61717
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS25140,ABA79981.1, 3.20.20.140, 272943 Molecular Weight 38981.35 Da.
    Residues 355 Isoelectric Point 5.97
    Sequence mtetipvfdghndfllrllrnpanretiwlkgdgtghldlprmkeggfaggffaiyvpspqahdaahfe ammdappfelplppmiraeqaqpvalamaghllwmeraargrfkvcrtaaevrschadgivsgimhmeg aeaigadldalhlfhslglrslgpvwsrptvfghgvpfrfpgspdtgeglteagrrlvaecnrlkimld lshlnekgfddvarlsdaplvathsnahavtpstrnltdrqlamiresrgmvglnfatsflredgrrsa emgwepvlrhldhlidrlgedhvgmgsdfdgatipqgiadvtglpalqaamrahgydeplmrklchenw ygllerswga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.22260
    Matthews' coefficent 2.18 Rfactor 0.17531
    Waters 448 Solvent Content 43.60

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3fdg
    1. Structure, mechanism, and substrate profile for Sco3058: The closest bacterial homologue to human renal dipeptidase
    JA Cummings, TT Nguyen, AA Fedorov, P Kolb - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch