.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fdx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative filament protein / universal stress protein F from Klebsiella pneumoniae. To be Published
    Site MCSG
    PDB Id 3fdx Target Id APC60640.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS25115,ABR76876.1, 3.40.50.620, 272620 Molecular Weight 15450.85 Da.
    Residues 140 Isoelectric Point 5.16
    Sequence ilvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmdelregsetqlk eiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsvlv vr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.58 Rfree 0.209
    Matthews' coefficent 3.36 Rfactor 0.187
    Waters 270 Solvent Content 63.38

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;FMT (FORMIC) x 2
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3fdx
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch