.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fes

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the ATP-dependent Clp Protease ClpC from Clostridium difficile. To be Published
    Site MCSG
    PDB Id 3fes Target Id APC62617.2
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS25152,CAJ66840.1, 272563 Molecular Weight 15575.09 Da.
    Residues 142 Isoelectric Point 5.42
    Sequence nfnrftqrakkaidlafesakslghnivgsehillgllreeegiaakvlskvgfteaylegkivdmegk geeisedivlsprskqilelsgmfanklktnyigtehillaiiqegegiankilnyagvndrtlaqlti dmmg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.82 Rfree 0.222
    Matthews' coefficent 2.76 Rfactor 0.187
    Waters 265 Solvent Content 55.41

    Ligand Information
    Ligands PG4 (TETRAETHYLENE) x 4;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3fes
    1. Copper insertion pathways for Cytochrome c Oxidase assembly in Saccharomyces cerevisiae
    KM Rigby - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch