.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ffy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative tetrapyrrole (corrin/porphyrin) methyltransferase from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3ffy Target Id APC62130.1
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25150,CAH06337.1, 3.30.950.10, 272559 Molecular Weight 12677.91 Da.
    Residues 112 Isoelectric Point 6.07
    Sequence tafvpalvasglpnekfcfegflpqkkgrmtklkslvdehrtmvfyesphrllktltqfaeyfgperqv svsreiskiheetvrgtlseliehftatdprgeivivlagidd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.231
    Matthews' coefficent 3.37 Rfactor 0.206
    Waters 37 Solvent Content 63.49

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch