.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fg8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PAS domain of RHA05790. To be Published
    Site MCSG
    PDB Id 3fg8 Target Id APC7734
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS25092,RHA05790_128_224, 101510 Molecular Weight 10713.58 Da.
    Residues 97 Isoelectric Point 5.33
    Sequence glgfmaldedlriiyvnsgclrhvrrsrdellgrvvtevlpetqgsyfdalcrkvlatgreqqtrvdsl yspgmtievtaaadsgalvvhfrdvtae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.22259
    Matthews' coefficent 1.96 Rfactor 0.16796
    Waters 772 Solvent Content 37.40

    Ligand Information
    Ligands 3PB ((3R)-3-(PHOSPHONOOXY)BUTANOIC) x 6
    Metals

    Jmol

     
    Google Scholar output for 3fg8
    1. Structure and signaling mechanism of Per-ARNT-Sim domains
    A Mglich, RA Ayers, K Moffat - Structure, 2009 - Elsevier
     
    2. Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c
    RK Jaiswal, G Manjeera, B Gopal - Biochemical and biophysical research , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch