.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fg9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an universal stress protein UspA family protein from Lactobacillus plantarum WCFS1. To be Published
    Site MCSG
    PDB Id 3fg9 Target Id APC60691
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS25117,CAD65733.1, 3.40.50.620, 220668 Molecular Weight 17118.49 Da.
    Residues 153 Isoelectric Point 4.65
    Sequence menqkmqeplvyrrilltvdeddntsserafryattlahdydvplgicsvlesedinifdsltpskiqa krkhvedvvaeyvqlaeqrgvnqveplvyeggdvddvileqvipefkpdllvtgadtefphskiagaig prlarkapisvivvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.47 Rfree 0.21235
    Matthews' coefficent 2.08 Rfactor 0.17732
    Waters 943 Solvent Content 41.00

    Ligand Information
    Ligands FMT (FORMIC) x 7;ACT (ACETATE) x 1
    Metals MG (MAGNESIUM) x 7

    Jmol

     
    Google Scholar output for 3fg9
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch