.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative ECF-type Sigma Factor Negative Effector from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 3fgg Target Id APC89526
    Related PDB Ids 3fh3 
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS5954,AAT54281.1, 260799 Molecular Weight 25790.46 Da.
    Residues 226 Isoelectric Point 8.67
    Sequence msldcrvresiqeeakgivappelkekvivqikmnqggrkrkkrliagvlaaaflipttgfayqsimad giygsfenlkkhagtmtleaymrfsaklseakdemgtkeyevftkelkkltnaklaygdsngnidydal ssekreemkkvsmglqpyfdklnghksskevltqeefdrymealmtheivrvktkstgaikveeipeay kerfikaeqfmeyvdekvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.259
    Matthews' coefficent 3.53 Rfactor 0.214
    Waters 138 Solvent Content 65.14

    Ligand Information
    Ligands GOL (GLYCEROL) x 6
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 3fgg
    1. Genetic history of hepatitis C virus in Venezuela: high diversity and long time of evolution of HCV genotype 2
    MZ Sulbarn, FA Di Lello, Y Sulbarn, C Cosson - PloS one, 2010 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch