.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fgx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Uncharacterised Protein Rbstp2171 from Bacillus Stearothermophilus. To be Published
    Site MCSG
    PDB Id 3fgx Target Id APC35815
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5512,RBSTP2171, 1422 Molecular Weight 12992.11 Da.
    Residues 114 Isoelectric Point 5.13
    Sequence mskakapintdelkqkygrvyeiriegleyengeeaefvfyftrpkvsdisrftkelnskpdmamknlt fscivpeqeeelrqaaeefpgltfntasrlmeivgasaatslkkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.279
    Matthews' coefficent 2.42 Rfactor 0.255
    Waters 5 Solvent Content 49.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fgx
    1. Long Noncontractile Tail Machines of Bacteriophages
    AR Davidson, L Cardarelli, LG Pell, DR Radford - Viral Molecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch