.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fh0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative universal stress protein KPN_01444 - ATPase. To be Published
    Site MCSG
    PDB Id 3fh0 Target Id APC60640
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS25113,ABR76876.1, 3.40.50.620, 272620 Molecular Weight 15582.04 Da.
    Residues 141 Isoelectric Point 5.16
    Sequence milvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmdelregsetql keiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsvl vvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.22695
    Matthews' coefficent 3.35 Rfactor 0.19111
    Waters 168 Solvent Content 63.25

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2;EDO (1,2-ETHANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3fh0
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     
    2. Structural and Biochemical Studies of the Human DEAD-box Helicase Dbp5 and Nucleoporin Nup214 Involved in mRNA Export
    H Moeller - 2009 - edoc.ub.uni-muenchen.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch