.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fh2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the PROBABLE ATP-DEPENDENT PROTEASE (HEAT SHOCK PROTEIN) from Corynebacterium glutamicum. To be Published
    Site MCSG
    PDB Id 3fh2 Target Id APC62772.1
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS25154,CAF20701.1, 196627 Molecular Weight 15831.58 Da.
    Residues 143 Isoelectric Point 6.21
    Sequence mferftdrarrvivlaqeearmlnhnyigtehillglihegegvaakalesmgisldavrqeveeiigq gsqpttghipftprakkvlelslreglqmghkyigteflllgliregegvaaqvlvklgadlprvrqqv iqlls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.23105
    Matthews' coefficent 2.16 Rfactor 0.18894
    Waters 131 Solvent Content 42.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fh2
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     
    2. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch