.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 3fiw Target Id APC6221
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS25075,NP_624585.1, 100226 Molecular Weight 21072.77 Da.
    Residues 190 Isoelectric Point 5.88
    Sequence mtkmnretvitealdlldevgldgvstrrlakrlgveqpslywyfrtkrdlltamaqaamaphaaeplp epgedwhgwflrntrsfrrtllarrdgarlhagsrptadldrvrrkmdflvasgvperhaqmamlaagr ftvgcvleeqaetgagdtadlpadvpeidhesafeaglalitdglvrhvdar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.25550
    Matthews' coefficent 2.62 Rfactor 0.18908
    Waters 426 Solvent Content 52.96

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch