.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fk8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of disulphide isomerase from Xylella fastidiosa Temecula1. To be Published
    Site MCSG
    PDB Id 3fk8 Target Id APC61824.1
    Molecular Characteristics
    Source Xylella fastidiosa temecula1
    Alias Ids TPS25148,AAO28893.1, 3.40.30.10, 183190 Molecular Weight 14436.64 Da.
    Residues 130 Isoelectric Point 8.56
    Sequence lnlpydehadawtqvkkalaagkrthkptllvfganwctdcraldkslrnqkntaliakhfevvkidvg nfdrnlelsqaygdpiqdgipavvvvnsdgkvryttkggelanarkmsdqgiydffakite
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.17916
    Matthews' coefficent 1.98 Rfactor 0.15421
    Waters 153 Solvent Content 37.79

    Ligand Information
    Ligands FMT (FORMIC) x 4
    Metals

    Jmol

     
    Google Scholar output for 3fk8
    1. A Machine Learning Approach for the Identification of Protein Secondary Structure Elements from Electron Cryo_Microscopy Density Maps
    D Si, S Ji, KA Nasr, J He - Biopolymers, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch