The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title thiol-disulfide oxidoreductase from Bacteroides fragilis NCTC 9343. To be Published
    Site MCSG
    PDB Id 3fkf Target Id APC61440.1
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25134,CAH09951.1,, 272559 Molecular Weight 16482.01 Da.
    Residues 145 Isoelectric Point 9.04
    Sequence kvtvgksapyfslpnekgeklsrsaerfrnrylllnfwaswcdpqpeanaelkrlnkeykknknfamlg isldidreawetaikkdtlswdqvcdftglssetakqyailtlptnillsptgkilardiqgealtgkl kellkte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.25816
    Matthews' coefficent 3.30 Rfactor 0.20792
    Waters 327 Solvent Content 62.67

    Ligand Information
    Ligands ACT (ACETATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch