.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fle

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of SE_1780 protein of unknown function from Staphylococcus epidermidis. To be Published
    Site MCSG
    PDB Id 3fle Target Id APC61035.1
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS25123,AAO05421.1, 3.40.50.1820, 176280 Molecular Weight 28005.30 Da.
    Residues 246 Isoelectric Point 8.70
    Sequence ikttatlflhgyggsersetfmvkqalnknvtnevitarvssegkvyfdkklsedaanpivkvefkdnk ngnfkenaywikevlsqlksqfgiqqfnfvghsmgnmsfafymknygddrhlpqlkkevniagvyngil nmnenvneiivdkqgkpsrmnaayrqllslykiycgkeievlniygdledgshsdgrvsnsssqslqyl lrgstksyqemkfkgakaqhsqlhenkdvaneiiqflwe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.223
    Matthews' coefficent 2.58 Rfactor 0.181
    Waters 448 Solvent Content 52.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch