.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fnc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative acetyltransferase from Listeria innocua. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fnc Target Id APC60777.1
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS25119,CAC95843.1, 3.40.630.30, 1642 Molecular Weight 18411.91 Da.
    Residues 160 Isoelectric Point 5.16
    Sequence mdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpfavleqadkvi gfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvnvekgnetaihfykakgfvq veeftedfygypletirfnlnh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.201
    Matthews' coefficent 2.43 Rfactor 0.169
    Waters 320 Solvent Content 49.38

    Ligand Information
    Ligands MLI (MALONATE) x 3;EDO (1,2-ETHANEDIOL) x 9
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch