.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fov

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of protein RPA0323 of unknown function from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3fov Target Id APC7380
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5128,NP_945676.1, 3.40.1350.10, 258594 Molecular Weight 14259.36 Da.
    Residues 130 Isoelectric Point 9.42
    Sequence maktdrsqpsvlariaafrtglsaeasaadylerqgyrilarrfktrcgeidlvaqrdalvafvevkar gnvddaayavtprqqsrivaaaeawlsrhpehamselrfdailiapntaprhlpgafdatp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.222
    Matthews' coefficent 1.80 Rfactor 0.188
    Waters 88 Solvent Content 31.60

    Ligand Information
    Ligands NO3 (NITRATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fov
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch