.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fq6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a methyltransferase domain from Bacteroides thetaiotaomicron VPI. To be Published
    Site MCSG
    PDB Id 3fq6 Target Id APC81722.1
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS25162,AAO77380.1, 3.30.950.10, 226186 Molecular Weight 12646.79 Da.
    Residues 112 Isoelectric Point 6.07
    Sequence tafvpalvasglpnekfcfegflpqkkgrqtrlkalaeehrtmvfyesphrllktltqfaeyfgterqa tvsreisklheetvrgslaeliehftateprgeivivlagidd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.36 Rfree 0.28571
    Matthews' coefficent 2.63 Rfactor 0.21383
    Waters 21 Solvent Content 53.23

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch