The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS1. To be Published
    Site MCSG
    PDB Id 3fuy Target Id APC7776
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS26850,AUS0180_1_158, 491076 Molecular Weight 17842.03 Da.
    Residues 158 Isoelectric Point 4.63
    Sequence mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmkgvrdaqqsigddtefgfkgp hirircvdiddkhtynamvyvdlivgtgaseveretaeelakeklraalqvdiadehscvtqfemklre ellssdsfhpdkdeyykdfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.2341
    Matthews' coefficent 2.23 Rfactor 0.1946
    Waters 163 Solvent Content 44.75

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch