.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fwz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TrkA-N domain of inner membrane protein ybaL from Escherichia coli. To be Published
    Site MCSG
    PDB Id 3fwz Target Id APC62901.3
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS25160,AAN79076.1, 3.40.50.720, 199310 Molecular Weight 15076.45 Da.
    Residues 137 Isoelectric Point 4.87
    Sequence vdicnhallvgygrvgsllgekllasdiplvvietsrtrvdelrergvravlgnaaneeimqlahleca kwliltipngyeageivasaraknpdieiiarahyddevayiterganqvvmgereiartmlelletp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.79 Rfree 0.20159
    Matthews' coefficent 2.14 Rfactor 0.16787
    Waters 201 Solvent Content 42.52

    Ligand Information
    Ligands AMP (ADENOSINE) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3fwz
    1. Mechanism of ligand-gated potassium efflux in bacterial pathogens
    TP Roosild, S Castronovo, J Healy - Proceedings of the , 2010 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch