.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fx3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative cAMP-binding regulatory protein from Silicibacter pomeroyi DSS-3. TO BE PUBLISHED
    Site MCSG
    PDB Id 3fx3 Target Id APC88413
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5909,YP_165150.1, PF00027.19, 246200 Molecular Weight 25819.18 Da.
    Residues 234 Isoelectric Point 5.67
    Sequence maheaqkaiarnsllirslpeqhvdallsqavwrsydrgetlflqeekaqaihvvidgwvklfrmtptg seavvsvftrgesfgeavalrntpypvsaeavtpcevmhipspvfvslmrrdpeicisilattfghlhs lvaqleqlkaqtgaqrvaefllelcdcdtgacevtlpydkmliagrlgmkpeslsrafsrlkaagvtvk rnhaeiediallrdyaesdpadswsks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.218
    Matthews' coefficent 3.27 Rfactor 0.181
    Waters 304 Solvent Content 62.39

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch