The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure from the mobile metagenome of Halifax Harbour Sewage Outfall: Integron Cassette Protein HFX_CASS2. To be Published
    Site MCSG
    PDB Id 3fxh Target Id APC7779
    Molecular Characteristics
    Source Lactobacillus crispatus jv v101
    Alias Ids TPS26854,AUS0255_1_114, 491076 Molecular Weight 12935.98 Da.
    Residues 114 Isoelectric Point 5.46
    Sequence mnnkhatsavheiireicrlvdsghsmtrdqfhelseqerfiaflaekysstiklyyladssplfekdt ssfienafgrhantvvmedfglksnalllainiclailreingev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.241
    Matthews' coefficent 1.96 Rfactor 0.186
    Waters 96 Solvent Content 37.21

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch