.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fy6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site MCSG
    PDB Id 3fy6 Target Id APC7826
    Molecular Characteristics
    Source Vibrio cholerae strain opvch_op2d
    Alias Ids TPS26860,AUS0118_1_119, 666 Molecular Weight 14114.04 Da.
    Residues 119 Isoelectric Point 4.63
    Sequence mtevnlniysprwgrhetyivelhkdymeismgavtikatysenqdpewseetlqdimnndsvyppeit qnlfqhawlewrkgaldndevtrelelvaqwvnkvteakpnsdfwrkyf*
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2238
    Matthews' coefficent 2.31 Rfactor 0.1695
    Waters 323 Solvent Content 46.68

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch