.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis. To be Published
    Site MCSG
    PDB Id 3fyb Target Id APC7960
    Molecular Characteristics
    Source Alcanivorax borkumensis sk2
    Alias Ids TPS25098,YP_692010.1, 393595 Molecular Weight 11853.81 Da.
    Residues 103 Isoelectric Point 5.13
    Sequence madidqasktemeaaafrhllrhldehkdvqnidlmiqadfcrnclakwlmeaateqgveldydgarey vygmpfaewktlyqkpaseaqlaafeakqaarkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.22147
    Matthews' coefficent 2.37 Rfactor 0.18710
    Waters 181 Solvent Content 48.13

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals CL (CHLORIDE) x 3;CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3fyb
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch