.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fz4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a possible arsenate reductase from Streptococcus mutans UA159. To be Published
    Site MCSG
    PDB Id 3fz4 Target Id APC61768
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS25144,AAN59290.1, 3.40.30.10, 210007 Molecular Weight 13418.62 Da.
    Residues 117 Isoelectric Point 5.82
    Sequence mltfyeypkcstcrrakaelddlawdydaidikknppaaslirnwlensglelkkffntsgqsyralgl kdklhqlsldeaanllasdgmlikrpllvkedkivqigyrtayedldf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.20786
    Matthews' coefficent 1.84 Rfactor 0.16661
    Waters 130 Solvent Content 33.16

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;FMT (FORMIC) x 4
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3fz4
    1. Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms
    AF Villadangos, K Van Belle, K Wahni - Molecular , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch