.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fz5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from Rhodobacter sphaeroides. To be Published
    Site MCSG
    PDB Id 3fz5 Target Id APC61725
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS25142,ABA78066.1, 3.40.30.10, 272943 Molecular Weight 22296.02 Da.
    Residues 199 Isoelectric Point 5.13
    Sequence mnpiefwfdfssgyaffaaqriealaaelgrtvlwrpymlgaafsvtgarglsstplkrdyaqrdwari arqrgltfrppadhphvalaatrafywieaqspdaatafaqrvfdlyfsdrldtaspeavsrlgpevgl epeallagiadpalketvrkigedavargifgspfflvddepfwgwdrmemmaewirtggw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.26003
    Matthews' coefficent 2.38 Rfactor 0.20414
    Waters 421 Solvent Content 48.29

    Ligand Information
    Ligands GTT (GLUTATHIONE) x 3;EDO (1,2-ETHANEDIOL) x 1;PGE (TRIETHYLENE) x 1
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch